PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_169520_rsxc.t1
Common NameSOVF_169520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 29086.1 Da    PI: 7.6965
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_169520_rsxc.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.11.4e-29959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krienk+ rqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+ey+s
  Sp_169520_rsxc.t1  9 KRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYAS 59
                       79***********************************************86 PP

2K-box88.81e-2986177899
              K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        + e++++ s+  e+ kL +++e L+r+ Rh++Ged + Lsl+eLq+LeqqL+ +lk+iRskKn+l++e+i++l kkek++qe+n++L+k ++
  Sp_169520_rsxc.t1  86 DSESQQEGSWAMEYPKLVSKLEALERNMRHYVGEDTDALSLRELQHLEQQLDVALKRIRSKKNQLMHESISQLNKKEKAMQEQNNQLSKLMM 177
                        37889999*******************************************************************************98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-33290IPR002100Transcription factor, MADS-box
CDDcd002652.31E-42281No hitNo description
PRINTSPR004041.8E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2687174IPR002487Transcription factor, K-box
PROSITE profilePS5129714.69892189IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYAST  60
DSSSMEKILE RYERYCYAER QLVAPDSESQ QEGSWAMEYP KLVSKLEALE RNMRHYVGED  120
TDALSLRELQ HLEQQLDVAL KRIRSKKNQL MHESISQLNK KEKAMQEQNN QLSKLMMEND  180
KKVVEQQKDE QNPSQVFMLS ASNPFQFPSL TIGGAYHEMR ELQMESANLE AQGPSRTNTN  240
IPAWMFSHHV GE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A5e-23275171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-23275171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-23275171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D5e-23275171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A5e-23275171Myocyte-specific enhancer factor 2A
3kov_B5e-23275171Myocyte-specific enhancer factor 2A
3kov_I5e-23275171Myocyte-specific enhancer factor 2A
3kov_J5e-23275171Myocyte-specific enhancer factor 2A
3p57_A5e-23275171Myocyte-specific enhancer factor 2A
3p57_B5e-23275171Myocyte-specific enhancer factor 2A
3p57_C5e-23275171Myocyte-specific enhancer factor 2A
3p57_D5e-23275171Myocyte-specific enhancer factor 2A
3p57_I5e-23275171Myocyte-specific enhancer factor 2A
3p57_J5e-23275171Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4148639e-40KC414863.1 Physalis pubescens PFFL mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666772.11e-134PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ424295e-96AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0K9QLY80.0A0A0K9QLY8_SPIOL; Uncharacterized protein
STRINGSolyc02g089210.2.14e-97(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26310.12e-87MIKC_MADS family protein